Exophilin 5 Antikörper (Middle Region)
-
- Target Alle Exophilin 5 (EXPH5) Antikörper anzeigen
- Exophilin 5 (EXPH5)
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser Exophilin 5 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- EXPH5 antibody was raised against the middle region of EXPH5
- Aufreinigung
- Affinity purified
- Immunogen
- EXPH5 antibody was raised using the middle region of EXPH5 corresponding to a region with amino acids QGRLWKPSFLKNPGFLKDDLRNPPNPSESLSSNSPSSQVPEDGLSPSEPL
- Top Product
- Discover our top product EXPH5 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
EXPH5 Blocking Peptide, catalog no. 33R-7572, is also available for use as a blocking control in assays to test for specificity of this EXPH5 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of EXPH5 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- Exophilin 5 (EXPH5)
- Andere Bezeichnung
- EXPH5 (EXPH5 Produkte)
- Synonyme
- RGD1560308 antikoerper, AC079869.22gm5 antikoerper, B130009M24Rik antikoerper, E030050P12 antikoerper, Kiaa0624 antikoerper, Slac2b antikoerper, slac2-b antikoerper, DKFZp469K2410 antikoerper, SLAC2-B antikoerper, SLAC2B antikoerper, exophilin 5 antikoerper, Exph5 antikoerper, EXPH5 antikoerper
- Hintergrund
- EXPH5 may act as a Rab effector protein and play a role in vesicle trafficking.
- Molekulargewicht
- 222 kDa (MW of target protein)
-