GTPBP2 Antikörper (N-Term)
-
- Target Alle GTPBP2 Antikörper anzeigen
- GTPBP2 (GTP Binding Protein 2 (GTPBP2))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser GTPBP2 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- GTPBP2 antibody was raised against the N terminal of GTPBP2
- Aufreinigung
- Affinity purified
- Immunogen
- GTPBP2 antibody was raised using the N terminal of GTPBP2 corresponding to a region with amino acids GCGGPKGKKKNGRNRGGKANNPPYLPPEAEDGNIEYKLKLVNPSQYRFEH
- Top Product
- Discover our top product GTPBP2 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
GTPBP2 Blocking Peptide, catalog no. 33R-3185, is also available for use as a blocking control in assays to test for specificity of this GTPBP2 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GTPBP2 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- GTPBP2 (GTP Binding Protein 2 (GTPBP2))
- Andere Bezeichnung
- GTPBP2 (GTPBP2 Produkte)
- Synonyme
- si:ch211-151i8.2 antikoerper, si:dkeyp-34c12.3 antikoerper, GB1 antikoerper, ZGB1 antikoerper, GTP binding protein 2 antikoerper, GTP binding protein 2 L homeolog antikoerper, GTP binding protein 2b antikoerper, GTPBP2 antikoerper, Gtpbp2 antikoerper, gtpbp2.L antikoerper, gtpbp2b antikoerper, gbp2 antikoerper
- Hintergrund
- GTP-binding proteins, or G proteins, constitute a superfamily capable of binding GTP or GDP. G proteins are activated by binding GTP and are inactivated by hydrolyzing GTP to GDP. This general mechanism enables G proteins to perform a wide range of biologic activities.
- Molekulargewicht
- 66 kDa (MW of target protein)
-