CMTR2 Antikörper (Middle Region)

Produktnummer ABIN632447

Produktdetails anti-CMTR2 Antikörper

Target: CMTR2 (Cap Methyltransferase 2 (CMTR2))

Bindungsspezifität: Middle Region

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser CMTR2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: FTSJD1 antibody was raised against the middle region of FTSJD1

Aufreinigung: Affinity purified

Immunogen: FTSJD1 antibody was raised using the middle region of FTSJD1 corresponding to a region with amino acids LMYLLNCCFDQVHVFKPATSKAGNSEVYVVCLHYKGREAIHPLLSKMTLN

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

FTSJD1 Blocking Peptide, catalog no. 33R-5216, is also available for use as a blocking control in assays to test for specificity of this FTSJD1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FTSJD1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu CMTR2

Target: CMTR2 (Cap Methyltransferase 2 (CMTR2))

Andere Bezeichnung: FTSJD1 (CMTR2 Produkte)

Synonyme: AFT antikoerper, FTSJD1 antikoerper, MTr2 antikoerper, cap methyltransferase 2 antikoerper, CMTR2 antikoerper

Hintergrund: The function of FTSJ protein is not widely studied, and is yet to be elucidated fully.

Molekulargewicht: 88 kDa (MW of target protein)