CMTR2 Antikörper (Middle Region)
-
- Target Alle CMTR2 Produkte
- CMTR2 (Cap Methyltransferase 2 (CMTR2))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser CMTR2 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- FTSJD1 antibody was raised against the middle region of FTSJD1
- Aufreinigung
- Affinity purified
- Immunogen
- FTSJD1 antibody was raised using the middle region of FTSJD1 corresponding to a region with amino acids LMYLLNCCFDQVHVFKPATSKAGNSEVYVVCLHYKGREAIHPLLSKMTLN
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
FTSJD1 Blocking Peptide, catalog no. 33R-5216, is also available for use as a blocking control in assays to test for specificity of this FTSJD1 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FTSJD1 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- CMTR2 (Cap Methyltransferase 2 (CMTR2))
- Andere Bezeichnung
- FTSJD1 (CMTR2 Produkte)
- Synonyme
- AFT antikoerper, FTSJD1 antikoerper, MTr2 antikoerper, cap methyltransferase 2 antikoerper, CMTR2 antikoerper
- Hintergrund
- The function of FTSJ protein is not widely studied, and is yet to be elucidated fully.
- Molekulargewicht
- 88 kDa (MW of target protein)
-