EIF5A2 Antikörper (N-Term)
-
- Target Alle EIF5A2 Antikörper anzeigen
- EIF5A2 (Eukaryotic Translation Initiation Factor 5A2 (EIF5A2))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser EIF5A2 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- EIF5 A2 antibody was raised against the N terminal of EIF5 2
- Aufreinigung
- Affinity purified
- Immunogen
- EIF5 A2 antibody was raised using the N terminal of EIF5 2 corresponding to a region with amino acids MADEIDFTTGDAGASSTYPMQCSALRKNGFVVLKGRPCKIVEMSTSKTGK
- Top Product
- Discover our top product EIF5A2 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
EIF5A2 Blocking Peptide, catalog no. 33R-5619, is also available for use as a blocking control in assays to test for specificity of this EIF5A2 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of EIF0 2 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- EIF5A2 (Eukaryotic Translation Initiation Factor 5A2 (EIF5A2))
- Andere Bezeichnung
- EIF5A2 (EIF5A2 Produkte)
- Hintergrund
- EIF5A2 is a mRNA-binding protein involved in translation elongation. EIF5A2 has an important function at the level of mRNA turnover, probably acting downstream of decapping.
- Molekulargewicht
- 17 kDa (MW of target protein)
-