AHCYL1 Antikörper (N-Term)
-
- Target Alle AHCYL1 Antikörper anzeigen
- AHCYL1 (Adenosylhomocysteinase-Like 1 (AHCYL1))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser AHCYL1 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- AHCYL1 antibody was raised against the N terminal of AHCYL1
- Aufreinigung
- Affinity purified
- Immunogen
- AHCYL1 antibody was raised using the N terminal of AHCYL1 corresponding to a region with amino acids TDSYSSAASYTDSSDDEVSPREKQQTNSKGSSNFCVKNIKQAEFGRREIE
- Top Product
- Discover our top product AHCYL1 Primärantikörper
-
anti-Adenosylhomocysteinase-Like 1 (AHCYL1) (AA 1-101) antibody
AHCYL1 Reaktivität: Human WB, ELISA, IHC (p) Wirt: Maus Monoclonal 5D6 unconjugated
anti-Adenosylhomocysteinase-Like 1 (AHCYL1) (AA 31-260) antibodyAHCYL1 Reaktivität: Human WB, IHC, ELISA Wirt: Kaninchen Polyclonal unconjugated
anti-Adenosylhomocysteinase-Like 1 (AHCYL1) (N-Term) antibodyAHCYL1 Reaktivität: Human, Maus, Ratte WB, IHC Wirt: Kaninchen Polyclonal unconjugated
anti-Adenosylhomocysteinase-Like 1 (AHCYL1) antibodyAHCYL1 Reaktivität: Human, Maus, Ratte IHC Wirt: Kaninchen Polyclonal unconjugated
anti-Adenosylhomocysteinase-Like 1 (AHCYL1) (AA 1-101) antibodyAHCYL1 Reaktivität: Human WB, ELISA Wirt: Maus Polyclonal unconjugated
anti-Adenosylhomocysteinase-Like 1 (AHCYL1) (N-Term) antibodyAHCYL1 Reaktivität: Human, Maus, Ratte, Rind (Kuh), Kaninchen, Meerschweinchen, Pferd, Hund, Zebrafisch (Danio rerio) WB Wirt: Kaninchen Polyclonal unconjugated
anti-Adenosylhomocysteinase-Like 1 (AHCYL1) (N-Term) antibodyAHCYL1 Reaktivität: Human, Maus, Ratte, Rind (Kuh), Hund, Zebrafisch (Danio rerio), Huhn, Xenopus laevis WB Wirt: Kaninchen Polyclonal unconjugated
anti-Adenosylhomocysteinase-Like 1 (AHCYL1) antibodyAHCYL1 Reaktivität: Human, Maus, Ratte IHC, ELISA Wirt: Kaninchen Polyclonal unconjugated
anti-Adenosylhomocysteinase-Like 1 (AHCYL1) (AA 1-530) antibodyAHCYL1 Reaktivität: Human WB Wirt: Kaninchen Polyclonal unconjugated
anti-Adenosylhomocysteinase-Like 1 (AHCYL1) (C-Term) antibodyAHCYL1 Reaktivität: Human, Maus, Ratte WB, IHC, ELISA Wirt: Kaninchen Polyclonal unconjugated
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
AHCYL1 Blocking Peptide, catalog no. 33R-9021, is also available for use as a blocking control in assays to test for specificity of this AHCYL1 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of AHCYL1 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- AHCYL1 (Adenosylhomocysteinase-Like 1 (AHCYL1))
- Andere Bezeichnung
- AHCYL1 (AHCYL1 Produkte)
- Synonyme
- irbit antikoerper, DCAL antikoerper, IRBIT antikoerper, PRO0233 antikoerper, XPVKONA antikoerper, cb586 antikoerper, wu:fj66f02 antikoerper, 1110034F20Rik antikoerper, AA409031 antikoerper, AA414901 antikoerper, Ahcy-rs3 antikoerper, Irbit antikoerper, adenosylhomocysteinase like 1 antikoerper, adenosylhomocysteinase like 1 S homeolog antikoerper, adenosylhomocysteinase-like 1 antikoerper, S-adenosylhomocysteine hydrolase-like 1 antikoerper, AHCYL1 antikoerper, ahcyl1 antikoerper, ahcyl1.S antikoerper, Ahcyl1 antikoerper
- Hintergrund
- The protein, an inositol 1,4,5-trisphosphate receptor-binding protein, specifically binds to and activates pancreas-type Na+/HCO3- cotransporter 1 (pNBC1).
- Molekulargewicht
- 59 kDa (MW of target protein)
-
