GBX1 Antikörper (Middle Region)

Produktnummer ABIN632458

Produktdetails anti-GBX1 Antikörper

Target: GBX1 (Gastrulation Brain Homeobox 1 (GBX1))

Bindungsspezifität: Middle Region

Reaktivität: Maus, Human, Ratte, Drosophila melanogaster

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser GBX1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: GBX1 antibody was raised against the middle region of Gbx-1

Aufreinigung: Affinity purified

Immunogen: GBX1 antibody was raised using the middle region of Gbx-1 corresponding to a region with amino acids AKWKRIKAGNVSSRSGEPVRNPKIVVPIPVHVNRFAVRSQHQQMEQGARP

Anwendungsinformationen

Applikationshinweise: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

GBX1 Blocking Peptide, catalog no. 33R-1314, is also available for use as a blocking control in assays to test for specificity of this GBX1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GBX-1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu GBX1

Target: GBX1 (Gastrulation Brain Homeobox 1 (GBX1))

Andere Bezeichnung: GBX1 (GBX1 Produkte)

Synonyme: Huh-17 antikoerper, Gbx-1 antikoerper, CHOX-7 antikoerper, GBX-1 antikoerper, cb619 antikoerper, fj77a06 antikoerper, wu:fj77a06 antikoerper, gastrulation brain homeobox 1 antikoerper, GBX1 antikoerper, Gbx1 antikoerper, gbx1 antikoerper

Hintergrund: GBX-1 contains 1 homeobox DNA-binding domain. The exact functions of GBX-1 remain unknown.

Molekulargewicht: 40 kDa (MW of target protein)