FAM124A Antikörper (Middle Region)

Produktnummer ABIN632463

Produktdetails anti-FAM124A Antikörper

Target: FAM124A (Family with Sequence Similarity 124A (FAM124A))

Bindungsspezifität: Middle Region

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser FAM124A Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: FAM124 A antibody was raised against the middle region of FAM124

Aufreinigung: Affinity purified

Immunogen: FAM124 A antibody was raised using the middle region of FAM124 corresponding to a region with amino acids VSRVTTEASWASLPFFTKRSSSSSATARAAPPAPSTSTLTDSSPQLPCDT

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

FAM124A Blocking Peptide, catalog no. 33R-9824, is also available for use as a blocking control in assays to test for specificity of this FAM124A antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FAM120 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu FAM124A

Target: FAM124A (Family with Sequence Similarity 124A (FAM124A))

Andere Bezeichnung: FAM124A (FAM124A Produkte)

Synonyme: family with sequence similarity 124 member A antikoerper, FAM124A antikoerper

Hintergrund: The function of FAM124A protein has not been widely studied, and is yet to be fully elucidated.

Molekulargewicht: 64 kDa (MW of target protein)