MAGEB3 Antikörper (N-Term)
-
- Target Alle MAGEB3 Antikörper anzeigen
- MAGEB3 (Melanoma Antigen Family B, 3 (MAGEB3))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser MAGEB3 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- MAGEB3 antibody was raised against the N terminal of MAGEB3
- Aufreinigung
- Affinity purified
- Immunogen
- MAGEB3 antibody was raised using the N terminal of MAGEB3 corresponding to a region with amino acids MPRGQKSTLHAREKRQQTRGQTQDHQGAQITATNKKKVSFSSPLILGATI
- Top Product
- Discover our top product MAGEB3 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
MAGEB3 Blocking Peptide, catalog no. 33R-6303, is also available for use as a blocking control in assays to test for specificity of this MAGEB3 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MAGEB3 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- MAGEB3 (Melanoma Antigen Family B, 3 (MAGEB3))
- Andere Bezeichnung
- MAGEB3 (MAGEB3 Produkte)
- Hintergrund
- This gene is a MAGE-B subfamily member of the MAGE gene family. MAGE family member proteins direct the expression of tumor antigens recognised on a human melanoma by autologous cytolytic T lymphocytes. There are two known clusters of MAGE genes on chromos
- Molekulargewicht
- 39 kDa (MW of target protein)
-