MAGEB3 Antikörper (N-Term)

Produktnummer ABIN632466

Produktdetails anti-MAGEB3 Antikörper

Target: MAGEB3 (Melanoma Antigen Family B, 3 (MAGEB3))

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser MAGEB3 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: MAGEB3 antibody was raised against the N terminal of MAGEB3

Aufreinigung: Affinity purified

Immunogen: MAGEB3 antibody was raised using the N terminal of MAGEB3 corresponding to a region with amino acids MPRGQKSTLHAREKRQQTRGQTQDHQGAQITATNKKKVSFSSPLILGATI

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

MAGEB3 Blocking Peptide, catalog no. 33R-6303, is also available for use as a blocking control in assays to test for specificity of this MAGEB3 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MAGEB3 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu MAGEB3

Target: MAGEB3 (Melanoma Antigen Family B, 3 (MAGEB3))

Andere Bezeichnung: MAGEB3 (MAGEB3 Produkte)

Synonyme: CT3.5 antikoerper, Smage3 antikoerper, Mage-b3 antikoerper, Mage-ps1 antikoerper, Mage-rs3 antikoerper, RGD1562343 antikoerper, MAGEB3 antikoerper, MAGE family member B3 antikoerper, melanoma antigen, family B, 3 antikoerper, melanoma-associated antigen B3 antikoerper, MAGE family member B5 antikoerper, MAGEB3 antikoerper, Mageb3 antikoerper, LOC509870 antikoerper, MAGEB5 antikoerper

Hintergrund: This gene is a MAGE-B subfamily member of the MAGE gene family. MAGE family member proteins direct the expression of tumor antigens recognised on a human melanoma by autologous cytolytic T lymphocytes. There are two known clusters of MAGE genes on chromos

Molekulargewicht: 39 kDa (MW of target protein)