PMM1 Antikörper (N-Term)

Produktnummer ABIN632467

Produktdetails anti-PMM1 Antikörper

Target: PMM1 (Phosphomannomutase 1 (PMM1))

Bindungsspezifität: N-Term

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser PMM1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: PMM1 antibody was raised against the N terminal of PMM1

Aufreinigung: Affinity purified

Immunogen: PMM1 antibody was raised using the N terminal of PMM1 corresponding to a region with amino acids MAVTAQAARRKERVLCLFDVDGTLTPARQKIDPEVAAFLQKLRSRVQIGV

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

PMM1 Blocking Peptide, catalog no. 33R-5802, is also available for use as a blocking control in assays to test for specificity of this PMM1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PMM1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu PMM1

Target: PMM1 (Phosphomannomutase 1 (PMM1))

Andere Bezeichnung: PMM1 (PMM1 Produkte)

Synonyme: Sec53 antikoerper, C77612 antikoerper, phosphomannomutase 1 antikoerper, phosphomannomutase 1 L homeolog antikoerper, PMM1 antikoerper, pmm1 antikoerper, Pmm1 antikoerper, pmm1.L antikoerper

Hintergrund: Phosphomannomutase catalyzes the conversion between D-mannose 6-phosphate and D-mannose 1-phosphate which is a substrate for GDP-mannose synthesis. GDP-mannose is used for synthesis of dolichol-phosphate-mannose, which is essential for N-linked glycosylat

Molekulargewicht: 30 kDa (MW of target protein)