FAM135B Antikörper (Middle Region)
-
- Target Alle FAM135B Produkte
- FAM135B (Family with Sequence Similarity 135, Member B (FAM135B))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser FAM135B Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- FAM135 B antibody was raised against the middle region of FAM135
- Aufreinigung
- Affinity purified
- Immunogen
- FAM135 B antibody was raised using the middle region of FAM135 corresponding to a region with amino acids TLVSTGLWLMQKLKKSGSLLQLTFRDNADLRKCFLYQLSQKTGLQYFKNV
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
FAM135B Blocking Peptide, catalog no. 33R-9192, is also available for use as a blocking control in assays to test for specificity of this FAM135B antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FAM130 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- FAM135B (Family with Sequence Similarity 135, Member B (FAM135B))
- Andere Bezeichnung
- FAM135B (FAM135B Produkte)
- Synonyme
- MGC81353 antikoerper, C8ORFK32 antikoerper, RGD1308133 antikoerper, 1700010C24Rik antikoerper, A830008O07Rik antikoerper, family with sequence similarity 135 member B antikoerper, family with sequence similarity 135 member B L homeolog antikoerper, family with sequence similarity 135, member B antikoerper, FAM135B antikoerper, fam135b.L antikoerper, Fam135b antikoerper
- Hintergrund
- The function of FAM135 protein is not widely studied, and is yet to be elucidated fully.
- Molekulargewicht
- 156 kDa (MW of target protein)
-