TRAPPC2L Antikörper (N-Term)

Produktnummer ABIN632473

Produktdetails anti-TRAPPC2L Antikörper

Target: TRAPPC2L

Bindungsspezifität: N-Term

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser TRAPPC2L Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: TRAPPC2 L antibody was raised against the N terminal of TRAPPC2

Aufreinigung: Affinity purified

Immunogen: TRAPPC2 L antibody was raised using the N terminal of TRAPPC2 corresponding to a region with amino acids MAVCIAVIAKENYPLYIRSTPTENELKFHYMVHTSLDVVDEKISAMGKAL

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

TRAPPC2L Blocking Peptide, catalog no. 33R-5796, is also available for use as a blocking control in assays to test for specificity of this TRAPPC2L antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TRAPPC0 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu TRAPPC2L

Target: TRAPPC2L

Abstract: TRAPPC2L Produkte

Synonyme: HSPC176 antikoerper, DDBDRAFT_0184526 antikoerper, DDBDRAFT_0266384 antikoerper, DDB_0184526 antikoerper, DDB_0266384 antikoerper, DKFZp469K0715 antikoerper, 1810017G16Rik antikoerper, AB030200 antikoerper, Hspc176 antikoerper, Tca17 antikoerper, RGD1304906 antikoerper, zgc:172319 antikoerper, zgc:92446 antikoerper, TPC2L antikoerper, trappc2l antikoerper, trafficking protein particle complex 2 like antikoerper, trafficking protein particle complex subunit 2-like protein antikoerper, trafficking protein particle complex 2-like antikoerper, trafficking protein particle complex 2-like L homeolog antikoerper, TRAPPC2L antikoerper, trappc2l antikoerper, Trappc2l antikoerper, LOC106562066 antikoerper, trappc2l.L antikoerper

Hintergrund: TRAPPC2L may play a role in vesicular transport from endoplasmic reticulum to Golgi.

Molekulargewicht: 16 kDa (MW of target protein)