ISPD Antikörper (N-Term)

Produktnummer ABIN632476

Produktdetails anti-ISPD Antikörper

Target: ISPD (Isoprenoid Synthase Domain Containing (ISPD))

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser ISPD Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: HCG_1745121 antibody was raised against the N terminal Of Hcg_1745121

Aufreinigung: Affinity purified

Immunogen: HCG_1745121 antibody was raised using the N terminal Of Hcg_1745121 corresponding to a region with amino acids MTPQSLLQTTLFLLSLLFLVQGAHGRGHREDFRFCSQRNQTHRSSLHYKP

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

HCG_1745121 Blocking Peptide, catalog no. 33R-6558, is also available for use as a blocking control in assays to test for specificity of this HCG_1745121 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HCG_1745121 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu ISPD

Target: ISPD (Isoprenoid Synthase Domain Containing (ISPD))

Andere Bezeichnung: HCG_1745121 (ISPD Produkte)

Synonyme: MDDGA7 antikoerper, Nip antikoerper, 4930579E17Rik antikoerper, AV040780 antikoerper, sb:eu371 antikoerper, zgc:154151 antikoerper, isoprenoid synthase domain containing antikoerper, ISPD antikoerper, ispd antikoerper, Ispd antikoerper

Hintergrund: The specific function of hCG_1745121 is not yet known.

Molekulargewicht: 44 kDa (MW of target protein)