AHNAK2 Antikörper (Middle Region)

Produktnummer ABIN632478

Produktdetails anti-AHNAK2 Antikörper

Target: AHNAK2 (AHNAK Nucleoprotein 2 (AHNAK2))

Bindungsspezifität: Middle Region

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser AHNAK2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: AHNAK2 antibody was raised against the middle region of AHNAK2

Aufreinigung: Affinity purified

Immunogen: AHNAK2 antibody was raised using the middle region of AHNAK2 corresponding to a region with amino acids AATRVCRTGRSRWRDVCRNFMRRYQSRVIQGLVAGETAQQICEDLRLCIP

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

AHNAK2 Blocking Peptide, catalog no. 33R-1056, is also available for use as a blocking control in assays to test for specificity of this AHNAK2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of AHNAK2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu AHNAK2

Target: AHNAK2 (AHNAK Nucleoprotein 2 (AHNAK2))

Andere Bezeichnung: AHNAK2 (AHNAK2 Produkte)

Synonyme: C14orf78 antikoerper, AI450948 antikoerper, Gm1185 antikoerper, Gm72 antikoerper, RGD1309696 antikoerper, AHNAK nucleoprotein 2 antikoerper, AHNAK2 antikoerper, Ahnak2 antikoerper

Hintergrund: The specific function of AHNAK2 is not yet known.

Molekulargewicht: 85 kDa (MW of target protein)