TBC1D16 Antikörper (N-Term)

Produktnummer ABIN632485

Produktdetails anti-TBC1D16 Antikörper

Target: TBC1D16 (TBC1 Domain Family, Member 16 (TBC1D16))

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser TBC1D16 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: TBC1 D16 antibody was raised against the N terminal of TBC1 16

Aufreinigung: Affinity purified

Immunogen: TBC1 D16 antibody was raised using the N terminal of TBC1 16 corresponding to a region with amino acids EMLGATLILAWVPNSRIQRQDEEALRYITPESSPVRKAPRPRGRRTRSSG

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

TBC1D16 Blocking Peptide, catalog no. 33R-2588, is also available for use as a blocking control in assays to test for specificity of this TBC1D16 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TBC0 16 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu TBC1D16

Target: TBC1D16 (TBC1 Domain Family, Member 16 (TBC1D16))

Andere Bezeichnung: TBC1D16 (TBC1D16 Produkte)

Synonyme: B930087K01 antikoerper, BC026530 antikoerper, Tcd1d16 antikoerper, TBC1 domain family member 16 antikoerper, TBC1 domain family, member 16 antikoerper, TBC1D16 antikoerper, Tbc1d16 antikoerper

Hintergrund: TBC1D16 may act as a GTPase-activating protein for Rab family proteins.

Molekulargewicht: 86 kDa (MW of target protein)