TBC1D16 Antikörper (N-Term)
-
- Target Alle TBC1D16 Antikörper anzeigen
- TBC1D16 (TBC1 Domain Family, Member 16 (TBC1D16))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser TBC1D16 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- TBC1 D16 antibody was raised against the N terminal of TBC1 16
- Aufreinigung
- Affinity purified
- Immunogen
- TBC1 D16 antibody was raised using the N terminal of TBC1 16 corresponding to a region with amino acids EMLGATLILAWVPNSRIQRQDEEALRYITPESSPVRKAPRPRGRRTRSSG
- Top Product
- Discover our top product TBC1D16 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
TBC1D16 Blocking Peptide, catalog no. 33R-2588, is also available for use as a blocking control in assays to test for specificity of this TBC1D16 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TBC0 16 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- TBC1D16 (TBC1 Domain Family, Member 16 (TBC1D16))
- Andere Bezeichnung
- TBC1D16 (TBC1D16 Produkte)
- Hintergrund
- TBC1D16 may act as a GTPase-activating protein for Rab family proteins.
- Molekulargewicht
- 86 kDa (MW of target protein)
-