ADH1A Antikörper
-
- Target Alle ADH1A Antikörper anzeigen
- ADH1A (Alcohol Dehydrogenase 1A (Class I), alpha Polypeptide (ADH1A))
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser ADH1A Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Affinity purified
- Immunogen
- ADH1 A antibody was raised using a synthetic peptide corresponding to a region with amino acids NYCLKNDVSNPQGTLQDGTSRFTCRRKPIHHFLGISTFSQYTVVDENAVA
- Top Product
- Discover our top product ADH1A Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
ADH1A Blocking Peptide, catalog no. 33R-6935, is also available for use as a blocking control in assays to test for specificity of this ADH1A antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ADH0 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- ADH1A (Alcohol Dehydrogenase 1A (Class I), alpha Polypeptide (ADH1A))
- Andere Bezeichnung
- ADH1A (ADH1A Produkte)
- Synonyme
- ADC1 antikoerper, ADH1 antikoerper, ADH antikoerper, ARVP antikoerper, AVP-NPII antikoerper, AVRP antikoerper, VP antikoerper, adh-1 antikoerper, ADH-AA antikoerper, AI194826 antikoerper, Adh-1 antikoerper, Adh-1-t antikoerper, Adh-1e antikoerper, Adh-1t antikoerper, Adh-3e antikoerper, Adh1-e antikoerper, Adh1-t antikoerper, Adh1tl antikoerper, Adh3-e antikoerper, Adh antikoerper, Adh1a antikoerper, Adh1c antikoerper, Adh1 antikoerper, Dvir\\Adh antikoerper, Dvir\\GJ18208 antikoerper, GJ18208 antikoerper, dvir_GLEANR_2771 antikoerper, ADH-1 antikoerper, ADH1B antikoerper, alcohol dehydrogenase ADH1 antikoerper, alcohol dehydrogenase 1A (class I), alpha polypeptide antikoerper, arginine vasopressin antikoerper, alcohol dehydrogenase 1 antikoerper, alcohol dehydrogenase 1A antikoerper, alcohol dehydrogenase 1 (class I) antikoerper, Alcohol dehydrogenase 1 antikoerper, alcohol dehydrogenase 1C (class I), gamma polypeptide antikoerper, ADH1 antikoerper, ADH1A antikoerper, AVP antikoerper, adh1 antikoerper, LOC744064 antikoerper, Adh1 antikoerper, Dvir\Adh1 antikoerper, ADH1C antikoerper
- Hintergrund
- ADH1A is class I alcohol dehydrogenase, alpha subunit, which is a member of the alcohol dehydrogenase family. Members of this enzyme family metabolize a wide variety of substrates, including ethanol, retinol, other aliphatic alcohols, hydroxysteroids, and lipid peroxidation products. Class I alcohol dehydrogenase, consisting of several homo- and heterodimers of alpha, beta, and gamma subunits, exhibits high activity for ethanol oxidation and plays a major role in ethanol catabolism.
- Molekulargewicht
- 40 kDa (MW of target protein)
-