MAGEA10 Antikörper (Middle Region)

Produktnummer ABIN632494

Produktdetails anti-MAGEA10 Antikörper

Target: MAGEA10 (Melanoma Antigen Family A, 10 (MAGEA10))

Bindungsspezifität: Middle Region

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser MAGEA10 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: MAGEA10 antibody was raised against the middle region of MAGEA10

Aufreinigung: Affinity purified

Immunogen: MAGEA10 antibody was raised using the middle region of MAGEA10 corresponding to a region with amino acids NMMGLYDGMEHLIYGEPRKLLTQDWVQENYLEYRQVPGSDPARYEFLWGP

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

MAGEA10 Blocking Peptide, catalog no. 33R-6797, is also available for use as a blocking control in assays to test for specificity of this MAGEA10 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MAGEA10 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu MAGEA10

Target: MAGEA10 (Melanoma Antigen Family A, 10 (MAGEA10))

Andere Bezeichnung: MAGEA10 (MAGEA10 Produkte)

Synonyme: MAGEA10 antikoerper, CT1.10 antikoerper, MAGE10 antikoerper, RGD1563693 antikoerper, MAGEA11 antikoerper, MAGE family member A10 antikoerper, melanoma-associated antigen 10 antikoerper, melanoma antigen family A, 10 antikoerper, putative MAGE domain-containing protein MAGEA13P antikoerper, MAGEA10 antikoerper, LOC509805 antikoerper, Magea10 antikoerper, LOC492173 antikoerper

Hintergrund: This gene is a member of the MAGEA gene family. The members of this family encode proteins with 50 to 80% sequence identity to each other.

Molekulargewicht: 41 kDa (MW of target protein)