PSG9 Antikörper (N-Term)

Produktnummer ABIN632496

Produktdetails anti-PSG9 Antikörper

Target: PSG9 (Pregnancy Specific beta-1-Glycoprotein 9 (PSG9))

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser PSG9 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: PSG9 antibody was raised against the N terminal of PSG9

Aufreinigung: Affinity purified

Immunogen: PSG9 antibody was raised using the N terminal of PSG9 corresponding to a region with amino acids YSNASLLIQNVTRKDAGTYTLHIIKRGDETREEIRHFTFTLYLETPKPYI

Anwendungsinformationen

Applikationshinweise: WB: 0.25 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

PSG9 Blocking Peptide, catalog no. 33R-10245, is also available for use as a blocking control in assays to test for specificity of this PSG9 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PSG9 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu PSG9

Target: PSG9 (Pregnancy Specific beta-1-Glycoprotein 9 (PSG9))

Andere Bezeichnung: PSG9 (PSG9 Produkte)

Synonyme: PS34 antikoerper, PSG11 antikoerper, PSGII antikoerper, PSBG-9 antikoerper, PSBG-11 antikoerper, pregnancy specific beta-1-glycoprotein 9 antikoerper, PSG9 antikoerper

Hintergrund: The human pregnancy-specific glycoproteins (PSGs) are a group of molecules that are mainly produced by the placental syncytiotrophoblasts during pregnancy. PSGs comprise a subgroup of the carcinoembryonic antigen (CEA) family, which belongs to the immunoglobulin superfamily.

Molekulargewicht: 54 kDa (MW of target protein)