PPP4R2 Antikörper (C-Term)

Produktnummer ABIN632513

Produktdetails anti-PPP4R2 Antikörper

Target: PPP4R2 (Protein Phosphatase 4, Regulatory Subunit 2 (PPP4R2))

Bindungsspezifität: C-Term

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser PPP4R2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: PPP4 R2 antibody was raised against the C terminal of PPP4 2

Aufreinigung: Affinity purified

Immunogen: PPP4 R2 antibody was raised using the C terminal of PPP4 2 corresponding to a region with amino acids DSRCTRQHCTEEDEEEDEEEEEESFMTSREMIPERKNQEKESDDALTVNE

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

PPP4R2 Blocking Peptide, catalog no. 33R-2177, is also available for use as a blocking control in assays to test for specificity of this PPP4R2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PPP0 2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu PPP4R2

Target: PPP4R2 (Protein Phosphatase 4, Regulatory Subunit 2 (PPP4R2))

Andere Bezeichnung: PPP4R2 (PPP4R2 Produkte)

Synonyme: PP4R2 antikoerper, BE691708 antikoerper, C230060M08Rik antikoerper, ppp4r2 antikoerper, fe11b04 antikoerper, wu:fe11b04 antikoerper, ppp4r2-B antikoerper, wu:fa17h08 antikoerper, wu:fc23g05 antikoerper, protein phosphatase 4 regulatory subunit 2 antikoerper, protein phosphatase 4, regulatory subunit 2 antikoerper, protein phosphatase 4, regulatory subunit 2a antikoerper, protein phosphatase 4 regulatory subunit 2 S homeolog antikoerper, protein phosphatase 4 regulatory subunit 2 L homeolog antikoerper, protein phosphatase 4, regulatory subunit 2b antikoerper, PPP4R2 antikoerper, Ppp4r2 antikoerper, ppp4r2a antikoerper, ppp4r2.S antikoerper, ppp4r2 antikoerper, ppp4r2.L antikoerper, ppp4r2b antikoerper

Hintergrund: PPP4R2 is the regulatory subunit of serine/threonine-protein phosphatase 4 (PP4). It may regulate the activity of PPP4C at centrosomal microtubule organizing centers. Its interaction with the SMN complex leads to enhance the temporal localization of snRNPs, suggesting a role of PPP4C in maturation of spliceosomal snRNPs. The PPP4C-PPP4R2-PPP4R3A PP4 complex specifically dephosphorylates H2AFX phosphorylated on 'Ser-140' (gamma-H2AFX) generated during DNA replication and required for DNA DSB repair.

Molekulargewicht: 47 kDa (MW of target protein)