PPP4R2 Antikörper (C-Term)
-
- Target Alle PPP4R2 Antikörper anzeigen
- PPP4R2 (Protein Phosphatase 4, Regulatory Subunit 2 (PPP4R2))
-
Bindungsspezifität
- C-Term
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser PPP4R2 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- PPP4 R2 antibody was raised against the C terminal of PPP4 2
- Aufreinigung
- Affinity purified
- Immunogen
- PPP4 R2 antibody was raised using the C terminal of PPP4 2 corresponding to a region with amino acids DSRCTRQHCTEEDEEEDEEEEEESFMTSREMIPERKNQEKESDDALTVNE
- Top Product
- Discover our top product PPP4R2 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
PPP4R2 Blocking Peptide, catalog no. 33R-2177, is also available for use as a blocking control in assays to test for specificity of this PPP4R2 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PPP0 2 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- PPP4R2 (Protein Phosphatase 4, Regulatory Subunit 2 (PPP4R2))
- Andere Bezeichnung
- PPP4R2 (PPP4R2 Produkte)
- Hintergrund
- PPP4R2 is the regulatory subunit of serine/threonine-protein phosphatase 4 (PP4). It may regulate the activity of PPP4C at centrosomal microtubule organizing centers. Its interaction with the SMN complex leads to enhance the temporal localization of snRNPs, suggesting a role of PPP4C in maturation of spliceosomal snRNPs. The PPP4C-PPP4R2-PPP4R3A PP4 complex specifically dephosphorylates H2AFX phosphorylated on 'Ser-140' (gamma-H2AFX) generated during DNA replication and required for DNA DSB repair.
- Molekulargewicht
- 47 kDa (MW of target protein)
-