ARHGAP28 Antikörper (N-Term)

Produktnummer ABIN632516

Produktdetails anti-ARHGAP28 Antikörper

Target: ARHGAP28 (rho GTPase Activating Protein 28 (ARHGAP28))

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser ARHGAP28 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: ARHGAP28 antibody was raised against the N terminal of ARHGAP28

Aufreinigung: Affinity purified

Immunogen: ARHGAP28 antibody was raised using the N terminal of ARHGAP28 corresponding to a region with amino acids KEGSFAVPRSDSVAILETIPVLPVHSNGSPEPGQPVQNAISDDDFLEKNI

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

ARHGAP28 Blocking Peptide, catalog no. 33R-4334, is also available for use as a blocking control in assays to test for specificity of this ARHGAP28 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ARHGAP28 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu ARHGAP28

Target: ARHGAP28 (rho GTPase Activating Protein 28 (ARHGAP28))

Andere Bezeichnung: ARHGAP28 (ARHGAP28 Produkte)

Synonyme: RGD1559882 antikoerper, ARHGAP28 antikoerper, AU044757 antikoerper, AW550892 antikoerper, E130310N06 antikoerper, Rho GTPase activating protein 28 antikoerper, Arhgap28 antikoerper, ARHGAP28 antikoerper

Hintergrund: ARHGAP28 contains 1 Rho-GAP domain. ARHGAP28 is a GTPase activator for the Rho-type GTPases by converting them to an inactive GDP-bound state.

Molekulargewicht: 63 kDa (MW of target protein)