C2orf42 Antikörper (N-Term)
-
- Target Alle C2orf42 Produkte
- C2orf42 (Chromosome 2 Open Reading Frame 42 (C2orf42))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human, Ratte, Maus
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser C2orf42 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- C2 ORF42 antibody was raised against the N terminal Of C2 rf42
- Aufreinigung
- Affinity purified
- Immunogen
- C2 ORF42 antibody was raised using the N terminal Of C2 rf42 corresponding to a region with amino acids EPNSLRTKVPAFLSDLGKATLRGIRKCPRCGTYNGTRGLSCKNKTCGTIF
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
C2ORF42 Blocking Peptide, catalog no. 33R-2639, is also available for use as a blocking control in assays to test for specificity of this C2ORF42 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C0 RF42 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- C2orf42 (Chromosome 2 Open Reading Frame 42 (C2orf42))
- Andere Bezeichnung
- C2ORF42 (C2orf42 Produkte)
- Synonyme
- C2orf42 antikoerper, chromosome 22 open reading frame, human C2orf42 antikoerper, chromosome 2 open reading frame 42 L homeolog antikoerper, chromosome 2 open reading frame 42 antikoerper, C22H2ORF42 antikoerper, c2orf42.L antikoerper, c2orf42 antikoerper, C2orf42 antikoerper
- Hintergrund
- The function of C2orf42 protein has not been widely studied, and is yet to be fully elucidated.
- Molekulargewicht
- 63 kDa (MW of target protein)
-