C2orf42 Antikörper (C-Term)

Produktnummer ABIN632522

Produktdetails anti-C2orf42 Antikörper

Target: C2orf42 (Chromosome 2 Open Reading Frame 42 (C2orf42))

Bindungsspezifität: C-Term

Reaktivität: Human, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser C2orf42 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: C2 ORF42 antibody was raised against the C terminal Of C2 rf42

Aufreinigung: Affinity purified

Immunogen: C2 ORF42 antibody was raised using the C terminal Of C2 rf42 corresponding to a region with amino acids ITRSFIQNRDGTYELFKCPKVEVESIAETYGRIEKQPVLRPLELKTFLKV

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

C2ORF42 Blocking Peptide, catalog no. 33R-4188, is also available for use as a blocking control in assays to test for specificity of this C2ORF42 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C0 RF42 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu C2orf42

Target: C2orf42 (Chromosome 2 Open Reading Frame 42 (C2orf42))

Andere Bezeichnung: C2ORF42 (C2orf42 Produkte)

Synonyme: C2orf42 antikoerper, chromosome 22 open reading frame, human C2orf42 antikoerper, chromosome 2 open reading frame 42 L homeolog antikoerper, chromosome 2 open reading frame 42 antikoerper, C22H2ORF42 antikoerper, c2orf42.L antikoerper, c2orf42 antikoerper, C2orf42 antikoerper

Hintergrund: The function of C2orf42 protein has not been widely studied, and is yet to be fully elucidated.

Molekulargewicht: 63 kDa (MW of target protein)