CLPB Antikörper

Produktnummer ABIN632528

Produktdetails anti-CLPB Antikörper

Target: CLPB (ClpB Caseinolytic Peptidase B Homolog (CLPB))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser CLPB Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Affinity purified

Immunogen: CLPB antibody was raised using a synthetic peptide corresponding to a region with amino acids QGGRFDTKCLAAATWGRLPGPEETLPGQDSWNGVPSRAGLGMCALAAALV

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

CLPB Blocking Peptide, catalog no. 33R-7560, is also available for use as a blocking control in assays to test for specificity of this CLPB antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CLPB antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu CLPB

Target: CLPB (ClpB Caseinolytic Peptidase B Homolog (CLPB))

Andere Bezeichnung: CLPB (CLPB Produkte)

Synonyme: HSP78 antikoerper, SKD3 antikoerper, AL118244 antikoerper, Skd3 antikoerper, ClpB homolog, mitochondrial AAA ATPase chaperonin antikoerper, ClpB caseinolytic peptidase B antikoerper, CLPB antikoerper, Clpb antikoerper

Hintergrund: CLPB belongs to the clpA/clpB family. It contains 4 ANK repeats. CLPB may function as a regulatory ATPase and be related to secretion/protein trafficking process.

Molekulargewicht: 78 kDa (MW of target protein)