CLPB Antikörper
-
- Target Alle CLPB Antikörper anzeigen
- CLPB (ClpB Caseinolytic Peptidase B Homolog (CLPB))
-
Reaktivität
- Human, Maus
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser CLPB Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Affinity purified
- Immunogen
- CLPB antibody was raised using a synthetic peptide corresponding to a region with amino acids ELIQLVNKELNFWAKRAKQRHNITLLWDREVADVLVDGYNVHYGARSIKH
- Top Product
- Discover our top product CLPB Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
CLPB Blocking Peptide, catalog no. 33R-2555, is also available for use as a blocking control in assays to test for specificity of this CLPB antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CLPB antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- CLPB (ClpB Caseinolytic Peptidase B Homolog (CLPB))
- Andere Bezeichnung
- CLPB (CLPB Produkte)
- Synonyme
- HSP78 antikoerper, SKD3 antikoerper, AL118244 antikoerper, Skd3 antikoerper, ClpB homolog, mitochondrial AAA ATPase chaperonin antikoerper, ClpB caseinolytic peptidase B antikoerper, CLPB antikoerper, Clpb antikoerper
- Hintergrund
- CLPB may function as a regulatory ATPase and be related to secretion/protein trafficking process.
- Molekulargewicht
- 78 kDa (MW of target protein)
-