Retinoic Acid Induced 12 (RAI12) (C-Term) Antikörper

Produktnummer ABIN632532

Produktdetails

Target: Retinoic Acid Induced 12 (RAI12)

Bindungsspezifität: C-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: C17 ORF81 antibody was raised against the C terminal Of C17 rf81

Aufreinigung: Affinity purified

Immunogen: C17 ORF81 antibody was raised using the C terminal Of C17 rf81 corresponding to a region with amino acids FSILPDFSLDLQEGPSVESQPYSDPHIPPVSKNAKARTRKCSLVSGHGRE

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

C17ORF81 Blocking Peptide, catalog no. 33R-3064, is also available for use as a blocking control in assays to test for specificity of this C17ORF81 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C10 RF81 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Antigendetails

Target: Retinoic Acid Induced 12 (RAI12)

Andere Bezeichnung: C17ORF81 (RAI12 Produkte)

Synonyme: C17orf81 antikoerper, DERP6 antikoerper, MST071 antikoerper, MSTP071 antikoerper, Derp6 antikoerper, Rai12 antikoerper, derp6 antikoerper, rai12 antikoerper, zgc:158278 antikoerper, zgc:158285 antikoerper, elongator acetyltransferase complex subunit 5 antikoerper, ELP5 antikoerper, Elp5 antikoerper, elp5 antikoerper

Hintergrund: C17orf81 belongs to the ELP5 family. C17orf81 may be involved in TP53-mediated transcriptional regulation.

Molekulargewicht: 31 kDa (MW of target protein)