TNNI3K Antikörper (N-Term)
-
- Target Alle TNNI3K Antikörper anzeigen
- TNNI3K (TNNI3 Interacting Kinase (TNNI3K))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser TNNI3K Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- TNNI3 K antibody was raised against the N terminal of TNNI3
- Aufreinigung
- Affinity purified
- Immunogen
- TNNI3 K antibody was raised using the N terminal of TNNI3 corresponding to a region with amino acids LLKFGADVNVSGEVGDRPLHLASAKGFLNIAKLLMEEGSKADVNAQDNED
- Top Product
- Discover our top product TNNI3K Primärantikörper
-
anti-TNNI3 Interacting Kinase (TNNI3K) (AA 1-843) antibody
TNNI3K Reaktivität: Human WB, IF Wirt: Kaninchen Polyclonal unconjugated
anti-TNNI3 Interacting Kinase (TNNI3K) (AA 1-75) antibodyTNNI3K Reaktivität: Human WB, IHC, ELISA Wirt: Kaninchen Polyclonal unconjugated
anti-TNNI3 Interacting Kinase (TNNI3K) antibodyTNNI3K Reaktivität: Human WB, IF, ICC Wirt: Kaninchen Polyclonal unconjugated
anti-TNNI3 Interacting Kinase (TNNI3K) (AA 1-75) antibodyTNNI3K Reaktivität: Human IHC, ELISA Wirt: Kaninchen Polyclonal unconjugated
anti-TNNI3 Interacting Kinase (TNNI3K) (Internal Region) antibodyTNNI3K Reaktivität: Human, Maus, Ratte IHC, ELISA Wirt: Kaninchen Polyclonal unconjugated
anti-TNNI3 Interacting Kinase (TNNI3K) (AA 755-804) antibodyTNNI3K Reaktivität: Human, Maus, Ratte, Rind (Kuh), Kaninchen, Pferd, Affe WB Wirt: Kaninchen Polyclonal unconjugated
anti-TNNI3 Interacting Kinase (TNNI3K) (AA 300-349) antibodyTNNI3K Reaktivität: Human, Maus, Ratte, Rind (Kuh), Kaninchen, Pferd, Huhn WB Wirt: Kaninchen Polyclonal unconjugated
anti-TNNI3 Interacting Kinase (TNNI3K) (AA 366-415) antibodyTNNI3K Reaktivität: Human, Maus, Ratte, Rind (Kuh), Kaninchen, Zebrafisch (Danio rerio), Affe, Huhn, Xenopus laevis WB Wirt: Kaninchen Polyclonal unconjugated
anti-TNNI3 Interacting Kinase (TNNI3K) (Internal Region) antibodyTNNI3K Reaktivität: Human, Maus, Ratte WB, IHC, ELISA Wirt: Kaninchen Polyclonal unconjugated
anti-TNNI3 Interacting Kinase (TNNI3K) (N-Term) antibodyTNNI3K Reaktivität: Human, Maus, Ratte, Rind (Kuh), Kaninchen, Pferd, Zebrafisch (Danio rerio), Hund WB Wirt: Kaninchen Polyclonal unconjugated
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
TNNI3K Blocking Peptide, catalog no. 33R-5154, is also available for use as a blocking control in assays to test for specificity of this TNNI3K antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TNNI0 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- TNNI3K (TNNI3 Interacting Kinase (TNNI3K))
- Andere Bezeichnung
- TNNI3K (TNNI3K Produkte)
- Synonyme
- CARK antikoerper, Cark antikoerper, D830019J24Rik antikoerper, TNNI3 interacting kinase antikoerper, serine/threonine-protein kinase TNNI3K antikoerper, TNNI3K antikoerper, LOC100592286 antikoerper, Tnni3k antikoerper
- Hintergrund
- TNNI3K may play a role in cardiac physiology.
- Molekulargewicht
- 103 kDa (MW of target protein)
-
