KCTD16 Antikörper (N-Term)

Produktnummer ABIN632535

Produktdetails anti-KCTD16 Antikörper

Target: KCTD16 (Potassium Channel Tetramerisation Domain Containing 16 (KCTD16))

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser KCTD16 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: KCTD16 antibody was raised against the N terminal of KCTD16

Aufreinigung: Affinity purified

Immunogen: KCTD16 antibody was raised using the N terminal of KCTD16 corresponding to a region with amino acids KREAEYFQLPDLVKLLTPDEIKQSPDEFCHSDFEDASQGSDTRICPPSSL

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

KCTD16 Blocking Peptide, catalog no. 33R-4621, is also available for use as a blocking control in assays to test for specificity of this KCTD16 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KCTD16 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu KCTD16

Target: KCTD16 (Potassium Channel Tetramerisation Domain Containing 16 (KCTD16))

Andere Bezeichnung: KCTD16 (KCTD16 Produkte)

Synonyme: RGD1559856 antikoerper, 4930434H12Rik antikoerper, Gm1267 antikoerper, lrl1 antikoerper, lrl3 antikoerper, potassium channel tetramerization domain containing 16 antikoerper, potassium channel tetramerisation domain containing 16 antikoerper, potassium channel tetramerization domain containing 16a antikoerper, potassium channel tetramerization domain containing 16b antikoerper, Kctd16 antikoerper, KCTD16 antikoerper, kctd16 antikoerper, kctd16a antikoerper, kctd16b antikoerper

Hintergrund: KCTD16 is an auxiliary subunit of GABA-B receptors that determine the pharmacology and kinetics of the receptor response. It increases agonist potency and markedly alter the G-protein signaling of the receptors by accelerating onset and promoting desensitization.

Molekulargewicht: 49 kDa (MW of target protein)

Pathways: Synaptic Membrane, Regulation of G-Protein Coupled Receptor Protein Signaling