GM2A Antikörper (N-Term)

Produktnummer ABIN632538

Produktdetails anti-GM2A Antikörper

Target: GM2A (GM2 Ganglioside Activator (GM2A))

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser GM2A Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: GM2 A antibody was raised against the N terminal of GM2

Aufreinigung: Affinity purified

Immunogen: GM2 A antibody was raised using the N terminal of GM2 corresponding to a region with amino acids SWDNCDEGKDPAVIRSLTLEPDPIIVPGNVTLSVMGSTSVPLSSPLKVDL

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

GM2A Blocking Peptide, catalog no. 33R-8939, is also available for use as a blocking control in assays to test for specificity of this GM2A antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GM0 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu GM2A

Target: GM2A (GM2 Ganglioside Activator (GM2A))

Andere Bezeichnung: GM2A (GM2A Produkte)

Synonyme: GM2A antikoerper, fb96e04 antikoerper, fb96e10 antikoerper, wu:fb96e04 antikoerper, wu:fb96e10 antikoerper, zgc:110188 antikoerper, MGC84154 antikoerper, GM2-AP antikoerper, SAP-3 antikoerper, AA408702 antikoerper, AW215435 antikoerper, GM2 ganglioside activator antikoerper, GM2 ganglioside activator L homeolog antikoerper, GM2 ganglioside activator protein antikoerper, Gm2a antikoerper, GM2A antikoerper, gm2a antikoerper, gm2a.L antikoerper

Hintergrund: This gene encodes a small glycolipid transport protein which acts as a substrate specific co-factor for the lysosomal enzyme beta-hexosaminidase A. Beta-hexosaminidase A, together with GM2 ganglioside activator, catalyzes the degradation of the ganglioside GM2, and other molecules containing terminal N-acetyl hexosamines. Mutations in this gene result in GM2-gangliosidosis type AB or the AB variant of Tay-Sachs disease. Alternative splicing results in multiple transcript variants.

Molekulargewicht: 18 kDa (MW of target protein)