GAS8 Antikörper (N-Term)
-
- Target Alle GAS8 Antikörper anzeigen
- GAS8 (Growth Arrest-Specific 8 (GAS8))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser GAS8 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- GAS8 antibody was raised against the N terminal of GAS8
- Aufreinigung
- Affinity purified
- Immunogen
- GAS8 antibody was raised using the N terminal of GAS8 corresponding to a region with amino acids VSRIREELDREREERNYFQLERDKIHTFWEITRRQLEEKKAELRNKDREM
- Top Product
- Discover our top product GAS8 Primärantikörper
-
anti-Growth Arrest-Specific 8 (GAS8) antibody
GAS8 Reaktivität: Human, Maus, Ratte ELISA, IHC Wirt: Kaninchen Polyclonal unconjugated
anti-Growth Arrest-Specific 8 (GAS8) (AA 143-192) antibodyGAS8 Reaktivität: Human, Maus, Ratte, Rind (Kuh), Hund, Pferd, Schwein, Affe WB Wirt: Kaninchen Polyclonal unconjugated
anti-Growth Arrest-Specific 8 (GAS8) (AA 35-84) antibodyGAS8 Reaktivität: Human, Maus, Ratte, Rind (Kuh), Hund, Pferd, Meerschweinchen, Kaninchen, Schwein, Zebrafisch (Danio rerio), Affe, Fledermaus, Huhn, Drosophila melanogaster, Xenopus laevis WB Wirt: Kaninchen Polyclonal unconjugated
anti-Growth Arrest-Specific 8 (GAS8) (Middle Region) antibodyGAS8 Reaktivität: Human, Maus, Ratte, Rind (Kuh), Hund, Pferd, Meerschweinchen, Kaninchen, Schwein IHC, WB Wirt: Kaninchen Polyclonal unconjugated
anti-Growth Arrest-Specific 8 (GAS8) (N-Term) antibodyGAS8 Reaktivität: Human, Maus, Ratte, Rind (Kuh), Hund, Pferd, Meerschweinchen, Kaninchen, Zebrafisch (Danio rerio) WB Wirt: Kaninchen Polyclonal unconjugated
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
GAS8 Blocking Peptide, catalog no. 33R-9820, is also available for use as a blocking control in assays to test for specificity of this GAS8 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GAS8 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- GAS8 (Growth Arrest-Specific 8 (GAS8))
- Andere Bezeichnung
- GAS8 (GAS8 Produkte)
- Hintergrund
- This gene includes 11 exons spanning 25 kb and maps to a region of chromosome 16 that is sometimes deleted in breast and prostrate cancer. The second intron contains an apparently intronless gene, C16orf3, that is transcribed in the opposite orientation. This gene is a putative tumor suppressor gene.
- Molekulargewicht
- 56 kDa (MW of target protein)
-
