CHCHD1 Antikörper (N-Term)

Produktnummer ABIN632544

Produktdetails anti-CHCHD1 Antikörper

Target: CHCHD1 (Coiled-Coil-Helix-Coiled-Coil-Helix Domain Containing 1 (CHCHD1))

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser CHCHD1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: CHCHD1 antibody was raised against the N terminal of CHCHD1

Aufreinigung: Affinity purified

Immunogen: CHCHD1 antibody was raised using the N terminal of CHCHD1 corresponding to a region with amino acids MATPSLRGRLARFGNPRKPVLKPNKPLILANRVGERRREKGEATCITEMS

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

CHCHD1 Blocking Peptide, catalog no. 33R-5787, is also available for use as a blocking control in assays to test for specificity of this CHCHD1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CHCHD1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu CHCHD1

Target: CHCHD1 (Coiled-Coil-Helix-Coiled-Coil-Helix Domain Containing 1 (CHCHD1))

Andere Bezeichnung: CHCHD1 (CHCHD1 Produkte)

Synonyme: c2360 antikoerper, MGC97719 antikoerper, im:7162785 antikoerper, zgc:162640 antikoerper, C10orf34 antikoerper, C2360 antikoerper, 1110001O19Rik antikoerper, 2400010G13Rik antikoerper, coiled-coil-helix-coiled-coil-helix domain containing 1 antikoerper, coiled-coil-helix-coiled-coil-helix domain containing 1 L homeolog antikoerper, Chchd1 antikoerper, chchd1.L antikoerper, CHCHD1 antikoerper, chchd1 antikoerper

Hintergrund: The function of CHCHD protein is not widely studied, and is yet to be elucidated fully.

Molekulargewicht: 13 kDa (MW of target protein)