GDAP2 Antikörper (N-Term)

Produktnummer ABIN632550

Produktdetails anti-GDAP2 Antikörper

Target: GDAP2 (Ganglioside-Induced Differentiation-Associated-Protein 2 (GDAP2))

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser GDAP2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: GDAP2 antibody was raised against the N terminal of GDAP2

Aufreinigung: Affinity purified

Immunogen: GDAP2 antibody was raised using the N terminal of GDAP2 corresponding to a region with amino acids CRTGEAKLTKGFNLAARFIIHTVGPKYKSRYRTAAESSLYSCYRNVLQLA

Anwendungsinformationen

Applikationshinweise: WB: 0.0625 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

GDAP2 Blocking Peptide, catalog no. 33R-1801, is also available for use as a blocking control in assays to test for specificity of this GDAP2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GDAP2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu GDAP2

Target: GDAP2 (Ganglioside-Induced Differentiation-Associated-Protein 2 (GDAP2))

Andere Bezeichnung: GDAP2 (GDAP2 Produkte)

Synonyme: MACROD3 antikoerper, dJ776P7.1 antikoerper, C77050 antikoerper, D3Ertd801e antikoerper, ganglioside induced differentiation associated protein 2 antikoerper, ganglioside-induced differentiation-associated-protein 2 antikoerper, GDAP2 antikoerper, Gdap2 antikoerper

Hintergrund: The function of GDAP protein is not widely studied, and is yet to be elucidated fully.

Molekulargewicht: 56 kDa (MW of target protein)