TRAPPC1 Antikörper (Middle Region)
-
- Target Alle TRAPPC1 Antikörper anzeigen
- TRAPPC1 (Trafficking Protein Particle Complex 1 (TRAPPC1))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser TRAPPC1 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- TRAPPC1 antibody was raised against the middle region of TRAPPC1
- Aufreinigung
- Affinity purified
- Immunogen
- TRAPPC1 antibody was raised using the middle region of TRAPPC1 corresponding to a region with amino acids YKLMYGMLFSIRSFVSKMSPLDMKDGFLAFQTSRYKLHYYETPTGIKVVM
- Top Product
- Discover our top product TRAPPC1 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
TRAPPC1 Blocking Peptide, catalog no. 33R-10152, is also available for use as a blocking control in assays to test for specificity of this TRAPPC1 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TRAPPC1 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- TRAPPC1 (Trafficking Protein Particle Complex 1 (TRAPPC1))
- Andere Bezeichnung
- TRAPPC1 (TRAPPC1 Produkte)
- Synonyme
- BET5 antikoerper, MUM2 antikoerper, D11Ertd172e antikoerper, zgc:100969 antikoerper, MGC83988 antikoerper, bet5 antikoerper, mum2 antikoerper, trafficking protein particle complex 1 antikoerper, trafficking protein particle complex 1 L homeolog antikoerper, TRAPPC1 antikoerper, Trappc1 antikoerper, trappc1 antikoerper, trappc1.L antikoerper
- Hintergrund
- This gene product plays a role in vesicular transport of proteins to the Golgi apparatus from the endoplasmic reticulum. The encoded protein is a component of the multisubunit transport protein particle (TRAPP) complex. Alternative splicing results in multiple transcript variants.
- Molekulargewicht
- 17 kDa (MW of target protein)
-