APOA2 Antikörper (N-Term)
-
- Target Alle APOA2 Antikörper anzeigen
- APOA2 (Apolipoprotein A-II (APOA2))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser APOA2 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- ApoA-II antibody was raised against the N terminal of APOA2
- Aufreinigung
- Affinity purified
- Immunogen
- ApoA-II antibody was raised using the N terminal of APOA2 corresponding to a region with amino acids MKLLAATVLLLTICSLEGALVRRQAKEPCVESLVSQYFQTVTDYGKDLME
- Top Product
- Discover our top product APOA2 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
ApoA-II Blocking Peptide, catalog no. 33R-6151, is also available for use as a blocking control in assays to test for specificity of this ApoA-II antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of APOA2 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- APOA2 (Apolipoprotein A-II (APOA2))
- Andere Bezeichnung
- ApoA-II (APOA2 Produkte)
- Hintergrund
- This gene encodes apolipoprotein (apo-) A-II, which is the second most abundant protein of the high density lipoprotein particles. The protein is found in plasma as a monomer, homodimer, or heterodimer with apolipoprotein D. Defects in this gene may result in apolipoprotein A-II deficiency or hypercholesterolemia.
- Molekulargewicht
- 9 kDa (MW of target protein)
- Pathways
- Regulation of Lipid Metabolism by PPARalpha, Production of Molecular Mediator of Immune Response, Negative Regulation of Transporter Activity, Lipid Metabolism
-