DNAJC12 Antikörper
-
- Target Alle DNAJC12 Antikörper anzeigen
- DNAJC12 (DnaJ (Hsp40) Homolog, Subfamily C, Member 12 (DNAJC12))
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser DNAJC12 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Affinity purified
- Immunogen
- DNAJC12 antibody was raised using a synthetic peptide corresponding to a region with amino acids EQKEPKPLEKSVSPQNSDSSGFADVNGWHLRFRWSKDAPSELLRKFRNYE
- Top Product
- Discover our top product DNAJC12 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
DNAJC12 Blocking Peptide, catalog no. 33R-2668, is also available for use as a blocking control in assays to test for specificity of this DNAJC12 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DNAJC12 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- DNAJC12 (DnaJ (Hsp40) Homolog, Subfamily C, Member 12 (DNAJC12))
- Andere Bezeichnung
- DNAJC12 (DNAJC12 Produkte)
- Synonyme
- DNAJC12 antikoerper, JDP1 antikoerper, Jdp1 antikoerper, mJDP1 antikoerper, DnaJ heat shock protein family (Hsp40) member C12 antikoerper, DnaJ (Hsp40) homolog, subfamily C, member 12 antikoerper, DNAJC12 antikoerper, dnajc12 antikoerper, Dnajc12 antikoerper
- Hintergrund
- This gene encodes a member of a subclass of the HSP40/DnaJ protein family. Members of this family of proteins are associated with complex assembly, protein folding, and export. Two transcript variants encoding distinct isoforms have been identified for this gene.
- Molekulargewicht
- 23 kDa (MW of target protein)
-