CAMK1D Antikörper (Middle Region)
-
- Target Alle CAMK1D Antikörper anzeigen
- CAMK1D (Calcium/calmodulin-Dependent Protein Kinase ID (CAMK1D))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser CAMK1D Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- CAMK1 D antibody was raised against the middle region of CAMK1
- Aufreinigung
- Affinity purified
- Immunogen
- CAMK1 D antibody was raised using the middle region of CAMK1 corresponding to a region with amino acids KNIHESVSAQIRKNFAKSKWRQAFNATAVVRHMRKLHLGSSLDSSNASVS
- Top Product
- Discover our top product CAMK1D Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
CAMK1D Blocking Peptide, catalog no. 33R-4567, is also available for use as a blocking control in assays to test for specificity of this CAMK1D antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CAMK0 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- CAMK1D (Calcium/calmodulin-Dependent Protein Kinase ID (CAMK1D))
- Andere Bezeichnung
- CAMK1D (CAMK1D Produkte)
- Synonyme
- CKLiK antikoerper, CaM-K1 antikoerper, CaMKID antikoerper, A630059D12Rik antikoerper, CaMKIdelta antikoerper, E030025C11Rik antikoerper, CAMK1D antikoerper, camk1d antikoerper, zgc:158713 antikoerper, RGD1560691 antikoerper, zgc:172284 antikoerper, cam-ki antikoerper, camk1d.L antikoerper, calcium/calmodulin dependent protein kinase ID antikoerper, calcium/calmodulin-dependent protein kinase ID antikoerper, calcium/calmodulin-dependent protein kinase 1Db antikoerper, calcium/calmodulin-dependent protein kinase 1Da antikoerper, calcium/calmodulin dependent protein kinase ID S homeolog antikoerper, CAMK1D antikoerper, Camk1d antikoerper, camk1db antikoerper, LOAG_08089 antikoerper, camk1da antikoerper, camk1d.S antikoerper
- Hintergrund
- This gene encodes a member of the Ca2+/calmodulin-dependent protein kinase 1 subfamily of serine/threonine kinases. The encoded protein may be involved in the regulation of granulocyte function through the chemokine signal transduction pathway. Alternatively spliced transcript variants encoding different isoforms of this gene have been described.
- Molekulargewicht
- 42 kDa (MW of target protein)
-