PRSS22 Antikörper (N-Term)

Produktnummer ABIN632566

Produktdetails anti-PRSS22 Antikörper

Target: PRSS22 (Protease, serine, 22 (PRSS22))

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser PRSS22 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: PRSS22 antibody was raised against the N terminal of PRSS22

Aufreinigung: Affinity purified

Immunogen: PRSS22 antibody was raised using the N terminal of PRSS22 corresponding to a region with amino acids IPVPPACGKPQQLNRVVGGEDSTDSEWPWIVSIQKNGTHHCAGSLLTSRW

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

PRSS22 Blocking Peptide, catalog no. 33R-4104, is also available for use as a blocking control in assays to test for specificity of this PRSS22 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PRSS22 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu PRSS22

Target: PRSS22 (Protease, serine, 22 (PRSS22))

Andere Bezeichnung: PRSS22 (PRSS22 Produkte)

Synonyme: BSSP-4 antikoerper, hBSSP-4 antikoerper, 4733401N09Rik antikoerper, SP001LA antikoerper, protease, serine, 22 antikoerper, protease, serine 22 antikoerper, Prss22 antikoerper, PRSS22 antikoerper

Hintergrund: This gene encodes a member of the trypsin family of serine proteases. The enzyme is expressed in the airways in a developmentally regulated manner. The gene is part of a cluster of serine protease genes on chromosome 16.

Molekulargewicht: 34 kDa (MW of target protein)