WDR49 Antikörper (N-Term)

Produktnummer ABIN632570

Produktdetails anti-WDR49 Antikörper

Target: WDR49 (WD Repeat Domain 49 (WDR49))

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser WDR49 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: WDR49 antibody was raised against the N terminal of WDR49

Aufreinigung: Affinity purified

Immunogen: WDR49 antibody was raised using the N terminal of WDR49 corresponding to a region with amino acids SQDFRCLFHFDEAHGRLFISFNNQLALLAMKSEASKRVKSHEKAVTCVLY

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

WDR49 Blocking Peptide, catalog no. 33R-8708, is also available for use as a blocking control in assays to test for specificity of this WDR49 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of WDR49 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu WDR49

Target: WDR49 (WD Repeat Domain 49 (WDR49))

Andere Bezeichnung: WDR49 (WDR49 Produkte)

Synonyme: EG213248 antikoerper, RGD1564622 antikoerper, WD repeat domain 49 antikoerper, WDR49 antikoerper, Wdr49 antikoerper, wdr49 antikoerper

Hintergrund: WDR49 contains 8 WD repeats. The exact function of WDR49 remains unknown.

Molekulargewicht: 79 kDa (MW of target protein)