CCBE1 Antikörper (Middle Region)
-
- Target Alle CCBE1 Antikörper anzeigen
- CCBE1 (Collagen and Calcium Binding EGF Domains 1 (CCBE1))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser CCBE1 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- CCBE1 antibody was raised against the middle region of CCBE1
- Aufreinigung
- Affinity purified
- Immunogen
- CCBE1 antibody was raised using the middle region of CCBE1 corresponding to a region with amino acids PMGPSPDLSHIKQGRRGPVGPPGAPGRDGSKGERGAPGPRGSPGPPGSFD
- Top Product
- Discover our top product CCBE1 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
CCBE1 Blocking Peptide, catalog no. 33R-7221, is also available for use as a blocking control in assays to test for specificity of this CCBE1 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CCBE1 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- CCBE1 (Collagen and Calcium Binding EGF Domains 1 (CCBE1))
- Andere Bezeichnung
- CCBE1 (CCBE1 Produkte)
- Synonyme
- 4933426F18Rik antikoerper, 9430093N24Rik antikoerper, mKIAA1983 antikoerper, RGD1307670 antikoerper, fof antikoerper, collagen and calcium binding EGF domains 1 antikoerper, CCBE1 antikoerper, Ccbe1 antikoerper, ccbe1 antikoerper
- Hintergrund
- This gene is thought to function in extracellular matrix remodeling and migration. It is predominantly expressed in the ovary, but down regulated in ovarian cancer cell lines and primary carcinomas, suggesting its role as a tumour suppressor. Mutations in this gene have been associated with Hennekam lymphangiectasia-lymphedema syndrome, a generalized lymphatic dysplasia in humans.
- Molekulargewicht
- 44 kDa (MW of target protein)
-