C18ORF25 Antikörper (N-Term)

Produktnummer ABIN632578

Produktdetails anti-C18ORF25 Antikörper

Target: C18ORF25 (Chromosome 18 Open Reading Frame 25 (C18ORF25))

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser C18ORF25 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: C18 orf25 antibody was raised against the N terminal of C18 rf25

Aufreinigung: Affinity purified

Immunogen: C18 orf25 antibody was raised using the N terminal of C18 rf25 corresponding to a region with amino acids MKMEEAVGKVEELIESEAPPKASEQETAKEEDGSVELESQVQKDGVADST

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

C18orf25 Blocking Peptide, catalog no. 33R-6153, is also available for use as a blocking control in assays to test for specificity of this C18orf25 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C10 rf25 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu C18ORF25

Target: C18ORF25 (Chromosome 18 Open Reading Frame 25 (C18ORF25))

Andere Bezeichnung: C18orf25 (C18ORF25 Produkte)

Synonyme: ARKL1 antikoerper, Akd2 antikoerper, chromosome 18 open reading frame 25 antikoerper, chromosome 18 open reading frame 25 L homeolog antikoerper, chromosome W open reading frame, human C18orf25 antikoerper, chromosome 18 open reading frame, human C18orf25 antikoerper, RIKEN cDNA 8030462N17 gene antikoerper, C18orf25 antikoerper, c18orf25.L antikoerper, c18orf25 antikoerper, CWH18ORF25 antikoerper, C18H18orf25 antikoerper, 8030462N17Rik antikoerper

Hintergrund: The function of C18orf25 protein has not been widely studied, and is yet to be fully elucidated.

Molekulargewicht: 37 kDa (MW of target protein)