C1orf144 Antikörper (N-Term)

Produktnummer ABIN632581

Produktdetails anti-C1orf144 Antikörper

Target: C1orf144 (Chromosome 1 Open Reading Frame 144 (C1orf144))

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser C1orf144 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: C1 orf144 antibody was raised against the N terminal of C1 rf144

Aufreinigung: Affinity purified

Immunogen: C1 orf144 antibody was raised using the N terminal of C1 rf144 corresponding to a region with amino acids MRRSLRAGKRRQTAGRKSKSPPKVPIVIQDDSLPAGPPPQIRILKRPTSN

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

C1orf144 Blocking Peptide, catalog no. 33R-6383, is also available for use as a blocking control in assays to test for specificity of this C1orf144 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C0 rf144 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu C1orf144

Target: C1orf144 (Chromosome 1 Open Reading Frame 144 (C1orf144))

Andere Bezeichnung: C1orf144 (C1orf144 Produkte)

Synonyme: MGC82291 antikoerper, MGC76116 antikoerper, DKFZp468H135 antikoerper, C1orf144 antikoerper, SZRD1 antikoerper, 1110022I03 antikoerper, D4Ertd22e antikoerper, C2H1orf144 antikoerper, wu:fb15h05 antikoerper, wu:fk86c07 antikoerper, zgc:109926 antikoerper, RGD1560286 antikoerper, SUZ RNA binding domain containing 1 L homeolog antikoerper, SUZ RNA binding domain containing 1 antikoerper, szrd1.L antikoerper, szrd1 antikoerper, SZRD1 antikoerper, Szrd1 antikoerper

Hintergrund: The function of Chromosome 1 ORF protein is not widely studied, and is yet to be elucidated fully.

Molekulargewicht: 15 kDa (MW of target protein)