C2orf30 Antikörper (Middle Region)

Produktnummer ABIN632582

Produktdetails anti-C2orf30 Antikörper

Target: C2orf30 (ERLEC1) (Endoplasmic Reticulum Lectin 1 (ERLEC1))

Bindungsspezifität: Middle Region

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser C2orf30 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: C2 orf30 antibody was raised against the middle region of C2 rf30

Aufreinigung: Affinity purified

Immunogen: C2 orf30 antibody was raised using the middle region of C2 rf30 corresponding to a region with amino acids GKHVHQYHEDKDSGKTSVVVGTWNQEEHIEWAKKNTARAYHLQDDGTQTV

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

C2orf30 Blocking Peptide, catalog no. 33R-3363, is also available for use as a blocking control in assays to test for specificity of this C2orf30 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C0 rf30 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu C2orf30

Target: C2orf30 (ERLEC1) (Endoplasmic Reticulum Lectin 1 (ERLEC1))

Andere Bezeichnung: C2orf30 (ERLEC1 Produkte)

Synonyme: C2orf30 antikoerper, CIM antikoerper, CL24936 antikoerper, CL25084 antikoerper, XTP3-B antikoerper, XTP3TPB antikoerper, 4933407N01Rik antikoerper, endoplasmic reticulum lectin 1 antikoerper, ERLEC1 antikoerper, Erlec1 antikoerper

Hintergrund: C2orf30 is a probable lectin that binds selectively to improperly folded lumenal proteins. May function in endoplasmic reticulum quality control and endoplasmic reticulum-associated degradation (ERAD) of both non-glycosylated proteins and glycoproteins.

Molekulargewicht: 55 kDa (MW of target protein)

Pathways: SARS-CoV-2 Protein Interaktom