TMEM42 Antikörper (N-Term)

Produktnummer ABIN632584

Produktdetails anti-TMEM42 Antikörper

Target: TMEM42 (Transmembrane Protein 42 (TMEM42))

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser TMEM42 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: TMEM42 antibody was raised against the N terminal of TMEM42

Aufreinigung: Affinity purified

Immunogen: TMEM42 antibody was raised using the N terminal of TMEM42 corresponding to a region with amino acids MAERPGPPGGAVSATAYPDTPAEFPPHLQAGAMRRRFWGVFNCLCAGAFG

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

TMEM42 Blocking Peptide, catalog no. 33R-5645, is also available for use as a blocking control in assays to test for specificity of this TMEM42 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TMEM42 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu TMEM42

Target: TMEM42 (Transmembrane Protein 42 (TMEM42))

Andere Bezeichnung: TMEM42 (TMEM42 Produkte)

Synonyme: 0610027O18Rik antikoerper, 4933429E06Rik antikoerper, AV003444 antikoerper, D9Ertd662e antikoerper, transmembrane protein 42 antikoerper, TMEM42 antikoerper, Tmem42 antikoerper

Hintergrund: The function of TMEM42 protein is not widely studied, and is yet to be elucidated fully.

Molekulargewicht: 17 kDa (MW of target protein)