FAM160B2 Antikörper (N-Term)

Produktnummer ABIN632592

Produktdetails anti-FAM160B2 Antikörper

Target: FAM160B2 (Family with Sequence Similarity 160, Member B2 (FAM160B2))

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser FAM160B2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: RAI16 antibody was raised against the N terminal of RAI16

Aufreinigung: Affinity purified

Immunogen: RAI16 antibody was raised using the N terminal of RAI16 corresponding to a region with amino acids HYYIESTDESTPAKKTDIPWRLKQMLDILVYEEQQQAAAGEAGPCLEYLL

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

RAI16 Blocking Peptide, catalog no. 33R-3883, is also available for use as a blocking control in assays to test for specificity of this RAI16 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RAI16 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu FAM160B2

Target: FAM160B2 (Family with Sequence Similarity 160, Member B2 (FAM160B2))

Andere Bezeichnung: RAI16 (FAM160B2 Produkte)

Synonyme: Rai16 antikoerper, RAI16 antikoerper, rai16 antikoerper, MGC146349 antikoerper, G430067P06Rik antikoerper, zgc:153945 antikoerper, family with sequence similarity 160, member B2 antikoerper, family with sequence similarity 160 member B2 antikoerper, Fam160b2 antikoerper, FAM160B2 antikoerper, fam160b2 antikoerper

Hintergrund: The function of RAI16 protein is not widely studied, and is yet to be elucidated fully.

Molekulargewicht: 82 kDa (MW of target protein)