C3orf33 Antikörper (Middle Region)
-
- Target Alle C3orf33 Produkte
- C3orf33 (Chromosome 3 Open Reading Frame 33 (C3orf33))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser C3orf33 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- C3 orf33 antibody was raised against the middle region of C3 rf33
- Aufreinigung
- Affinity purified
- Immunogen
- C3 orf33 antibody was raised using the middle region of C3 rf33 corresponding to a region with amino acids NSALFCYLLVSKGGYFSVNLNEEILRRGLGKTVLVKGLKYDSKIYWTVHR
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
C3orf33 Blocking Peptide, catalog no. 33R-6869, is also available for use as a blocking control in assays to test for specificity of this C3orf33 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C0 rf33 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- C3orf33 (Chromosome 3 Open Reading Frame 33 (C3orf33))
- Andere Bezeichnung
- C3orf33 (C3orf33 Produkte)
- Synonyme
- AC3-33 antikoerper, MGC99235 antikoerper, chromosome 3 open reading frame 33 antikoerper, chromosome 3 open reading frame 33 L homeolog antikoerper, RIKEN cDNA E130311K13 gene antikoerper, C3orf33 antikoerper, c3orf33.L antikoerper, E130311K13Rik antikoerper
- Hintergrund
- The function of Chromosome 3 ORF protein is not widely studied, and is yet to be elucidated fully.
- Molekulargewicht
- 29 kDa (MW of target protein)
-