THYN1 Antikörper (N-Term)
-
- Target Alle THYN1 Antikörper anzeigen
- THYN1 (Thymocyte Nuclear Protein 1 (THYN1))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser THYN1 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- THYN1 antibody was raised against the N terminal of THYN1
- Aufreinigung
- Affinity purified
- Immunogen
- THYN1 antibody was raised using the N terminal of THYN1 corresponding to a region with amino acids MSRPRKRLAGTSGSDKGLSGKRTKTENSGEALAKVEDSNPQKTSATKNCL
- Top Product
- Discover our top product THYN1 Primärantikörper
-
anti-Thymocyte Nuclear Protein 1 (THYN1) antibody
THYN1 Reaktivität: Human WB, ELISA Wirt: Kaninchen Polyclonal unconjugated
anti-Thymocyte Nuclear Protein 1 (THYN1) (N-Term) antibodyTHYN1 Reaktivität: Human, Ratte, Maus, Meerschweinchen, Affe WB Wirt: Kaninchen Polyclonal unconjugated
anti-Thymocyte Nuclear Protein 1 (THYN1) (AA 144-193) antibodyTHYN1 Reaktivität: Human, Ratte, Rind (Kuh), Pferd, Schwein, Kaninchen, Hamster WB Wirt: Kaninchen Polyclonal unconjugated
anti-Thymocyte Nuclear Protein 1 (THYN1) (AA 1-225) antibodyTHYN1 Reaktivität: Human WB, IHC, ICC Wirt: Kaninchen Polyclonal unconjugated
anti-Thymocyte Nuclear Protein 1 (THYN1) (AA 1-226) antibodyTHYN1 Reaktivität: Ratte WB, IHC, ICC Wirt: Kaninchen Polyclonal unconjugated
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
THYN1 Blocking Peptide, catalog no. 33R-6487, is also available for use as a blocking control in assays to test for specificity of this THYN1 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of THYN1 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- THYN1 (Thymocyte Nuclear Protein 1 (THYN1))
- Andere Bezeichnung
- THYN1 (THYN1 Produkte)
- Synonyme
- my105 antikoerper, thy28 antikoerper, mds012 antikoerper, hspc144 antikoerper, thy28kd antikoerper, zgc:66269 antikoerper, MDS012 antikoerper, MY105 antikoerper, THY28 antikoerper, THY28KD antikoerper, D730042P09Rik antikoerper, HSPC144 antikoerper, Thy28 antikoerper, thymocyte nuclear protein 1 antikoerper, Thymocyte nuclear protein 1 antikoerper, thyn1 antikoerper, THYN1 antikoerper, PTRG_09699 antikoerper, MCYG_02665 antikoerper, EIO_2684 antikoerper, thYN1 antikoerper, Thyn1 antikoerper
- Hintergrund
- THYN1 is a protein that is highly conserved among vertebrates and plant species and may be involved in the induction of apoptosis.
- Molekulargewicht
- 26 kDa (MW of target protein)
-
