ZPBP2 Antikörper (Middle Region)

Produktnummer ABIN632617

Produktdetails anti-ZPBP2 Antikörper

Target: ZPBP2 (Zona Pellucida Binding Protein 2 (ZPBP2))

Bindungsspezifität: Middle Region

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser ZPBP2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: ZPBP2 antibody was raised against the middle region of ZPBP2

Aufreinigung: Affinity purified

Immunogen: ZPBP2 antibody was raised using the middle region of ZPBP2 corresponding to a region with amino acids VRLDSCRPGFGKNERLHSNCASCCVVCSPATFSPDVNVTCQTCVSVLTYG

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

ZPBP2 Blocking Peptide, catalog no. 33R-9776, is also available for use as a blocking control in assays to test for specificity of this ZPBP2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ZPBP2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu ZPBP2

Target: ZPBP2 (Zona Pellucida Binding Protein 2 (ZPBP2))

Andere Bezeichnung: ZPBP2 (ZPBP2 Produkte)

Synonyme: ZPBP2 antikoerper, ZPBPL antikoerper, 1700017D11Rik antikoerper, 2610022C02Rik antikoerper, zona pellucida binding protein 2 antikoerper, ZPBP2 antikoerper, Zpbp2 antikoerper

Hintergrund: ZPBP2 may be implicated in gamete interaction during fertilization.

Molekulargewicht: 35 kDa (MW of target protein)