AKR1C2 Antikörper
-
- Target Alle AKR1C2 Antikörper anzeigen
- AKR1C2 (Aldo-keto Reductase Family 1, Member C2 (AKR1C2))
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser AKR1C2 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Affinity purified
- Immunogen
- AKR1 C2 antibody was raised using a synthetic peptide corresponding to a region with amino acids LEAVKLAIEAGFHHIDSAHVYNNEEQVGLAIRSKIADGSVKREDIFYTSK
- Top Product
- Discover our top product AKR1C2 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
AKR1C2 Blocking Peptide, catalog no. 33R-4880, is also available for use as a blocking control in assays to test for specificity of this AKR1C2 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of AKR0 2 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- AKR1C2 (Aldo-keto Reductase Family 1, Member C2 (AKR1C2))
- Andere Bezeichnung
- AKR1C2 (AKR1C2 Produkte)
- Synonyme
- AKR1C-pseudo antikoerper, BABP antikoerper, DD antikoerper, DD2 antikoerper, DDH2 antikoerper, HAKRD antikoerper, HBAB antikoerper, MCDR2 antikoerper, SRXY8 antikoerper, Akr1c21 antikoerper, aldo-keto reductase family 1 member C2 antikoerper, aldo-keto reductase family 1, member C2 antikoerper, AKR1C2 antikoerper, Akr1c2 antikoerper
- Hintergrund
- This gene encodes a member of the aldo/keto reductase superfamily, which consists of more than 40 known enzymes and proteins. These enzymes catalyze the conversion of aldehydes and ketones to their corresponding alcohols using NADH and/or NADPH as cofactors. The enzymes display overlapping but distinct substrate specificity. This enzyme binds bile acid with high affinity, and shows minimal 3-alpha-hydroxysteroid dehydrogenase activity. This gene shares high sequence identity with three other gene members and is clustered with those three genes at chromosome 10p15-p14.
- Molekulargewicht
- 37 kDa (MW of target protein)
- Pathways
- Steroid Hormone Biosynthesis, C21-Steroid Hormone Metabolic Process
-