Neurexophilin 4 Antikörper (N-Term)

Produktnummer ABIN632622

Produktdetails anti-Neurexophilin 4 Antikörper

Target: Neurexophilin 4 (NXPH4)

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser Neurexophilin 4 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: Neurexophilin 4 antibody was raised against the N terminal of NXPH4

Aufreinigung: Affinity purified

Immunogen: Neurexophilin 4 antibody was raised using the N terminal of NXPH4 corresponding to a region with amino acids MRLLPEWFLLLFGPWLLRKAVSAQIPESGRPQYLGLRPAAAGAGAPGQQL

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

Neurexophilin 4 Blocking Peptide, catalog no. 33R-6369, is also available for use as a blocking control in assays to test for specificity of this Neurexophilin 4 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NXPH4 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu Neurexophilin 4

Target: Neurexophilin 4 (NXPH4)

Andere Bezeichnung: Neurexophilin 4 (NXPH4 Produkte)

Synonyme: NXPH4 antikoerper, NPH4 antikoerper, 1110036M10Rik antikoerper, AI851051 antikoerper, Nph4 antikoerper, neurexophilin 4 antikoerper, NXPH4 antikoerper, Nxph4 antikoerper

Hintergrund: NXPH4 may be signaling molecules that resemble neuropeptides and that act by binding to alpha-neurexins and possibly other receptors.

Molekulargewicht: 34 kDa (MW of target protein)