SPATA24 Antikörper (C-Term)
-
- Target Alle SPATA24 Antikörper anzeigen
- SPATA24 (Spermatogenesis Associated 24 (SPATA24))
- Bindungsspezifität
- C-Term
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser SPATA24 Antikörper ist unkonjugiert
- Applikation
- Western Blotting (WB)
- Spezifität
- SPATA24 antibody was raised against the c terminal of SPATA24
- Aufreinigung
- Affinity purified
- Immunogen
- SPATA24 antibody was raised using the C terminal of SPATA24 corresponding to a region with amino acids LQQVISQQKQIFRNHMSDFRIQKQQESYMAQVLDQKHKKASGTRQARSHQ
- Top Product
- Discover our top product SPATA24 Primärantikörper
-
anti-Spermatogenesis Associated 24 (SPATA24) (C-Term) antibody
SPATA24 Reaktivität: Human, Kaninchen, Affe WB Wirt: Kaninchen Polyclonal unconjugated
anti-Spermatogenesis Associated 24 (SPATA24) (C-Term) antibodySPATA24 Reaktivität: Human, Kaninchen, Pferd, Schwein, Ratte, Hund, Meerschweinchen WB Wirt: Kaninchen Polyclonal unconjugated
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
SPATA24 Blocking Peptide, catalog no. 33R-5332, is also available for use as a blocking control in assays to test for specificity of this SPATA24 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SPATA24 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- SPATA24 (Spermatogenesis Associated 24 (SPATA24))
- Andere Bezeichnung
- SPATA24 (SPATA24 Produkte)
- Synonyme
- CCDC161 antikoerper, T6441 antikoerper, 2700012K08Rik antikoerper, 4930583E11Rik antikoerper, 5133400G04Rik antikoerper, AU016220 antikoerper, TIPT antikoerper, TIPT2 antikoerper, RGD1311742 antikoerper, spermatogenesis associated 24 antikoerper, SPATA24 antikoerper, Spata24 antikoerper
- Hintergrund
- SPATA24 binds DNA with high affinity but does not bind to TATA boxes.SPATA24 synergises with GMNN and TBP in activation of TATA box-containing promoters and with GMNN and TBPL1 in activation of the NF1 TATA-less promoter.
- Molekulargewicht
- 23 kDa (MW of target protein)
-
