PLA2G4E Antikörper (C-Term)

Produktnummer ABIN632624

Produktdetails anti-PLA2G4E Antikörper

Target: PLA2G4E (Phospholipase A2, Group IVE (PLA2G4E))

Bindungsspezifität: C-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser PLA2G4E Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: PLA2 G2 antibody was raised against the c terminal of PLA2 2

Aufreinigung: Affinity purified

Immunogen: PLA2 G2 antibody was raised using the C terminal of PLA2 2 corresponding to a region with amino acids TFFPLINDTFRKYKAPGVERSPEELEQGQVDIYGPKTPYATKELTYTEAT

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

PLA2G4E Blocking Peptide, catalog no. 33R-9063, is also available for use as a blocking control in assays to test for specificity of this PLA2G4E antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PLA0 0 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu PLA2G4E

Target: PLA2G4E (Phospholipase A2, Group IVE (PLA2G4E))

Andere Bezeichnung: PLA2G4E (PLA2G4E Produkte)

Synonyme: RGD1310595 antikoerper, 2310026J01Rik antikoerper, C230096D22 antikoerper, Pla2epsilon antikoerper, phospholipase A2, group IVE antikoerper, phospholipase A2 group IVE-like 6 antikoerper, phospholipase A2 group IVE antikoerper, Pla2g4e antikoerper, PLA2G4EL6 antikoerper, PLA2G4E antikoerper

Hintergrund: PLA2G4E is a calcium-dependent phospholipase A2 that selectively hydrolyzes glycerophospholipids in the sn-2 position.

Molekulargewicht: 96 kDa (MW of target protein)

Pathways: Inositol Metabolic Process, VEGF Signaling