PLA2G4E Antikörper (C-Term)
-
- Target Alle PLA2G4E Antikörper anzeigen
- PLA2G4E (Phospholipase A2, Group IVE (PLA2G4E))
-
Bindungsspezifität
- C-Term
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser PLA2G4E Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- PLA2 G2 antibody was raised against the c terminal of PLA2 2
- Aufreinigung
- Affinity purified
- Immunogen
- PLA2 G2 antibody was raised using the C terminal of PLA2 2 corresponding to a region with amino acids TFFPLINDTFRKYKAPGVERSPEELEQGQVDIYGPKTPYATKELTYTEAT
- Top Product
- Discover our top product PLA2G4E Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
PLA2G4E Blocking Peptide, catalog no. 33R-9063, is also available for use as a blocking control in assays to test for specificity of this PLA2G4E antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PLA0 0 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- PLA2G4E (Phospholipase A2, Group IVE (PLA2G4E))
- Andere Bezeichnung
- PLA2G4E (PLA2G4E Produkte)
- Hintergrund
- PLA2G4E is a calcium-dependent phospholipase A2 that selectively hydrolyzes glycerophospholipids in the sn-2 position.
- Molekulargewicht
- 96 kDa (MW of target protein)
- Pathways
- Inositol Metabolic Process, VEGF Signaling
-