TOM1 Antikörper
-
- Target Alle TOM1 Antikörper anzeigen
- TOM1 (Target of Myb 1 (TOM1))
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser TOM1 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Affinity purified
- Immunogen
- TOM1 antibody was raised using a synthetic peptide corresponding to a region with amino acids SGRLEDEFDMFALTRGSSLADQRKEVKYEAPQATDGLAGALDARQQSTGA
- Top Product
- Discover our top product TOM1 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
TOM1 Blocking Peptide, catalog no. 33R-8486, is also available for use as a blocking control in assays to test for specificity of this TOM1 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TOM1 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- TOM1 (Target of Myb 1 (TOM1))
- Andere Bezeichnung
- TOM1 (TOM1 Produkte)
- Synonyme
- TOM-1B antikoerper, tom-1A antikoerper, target of myb1 membrane trafficking protein antikoerper, target of myb1 trafficking protein antikoerper, TOM1 antikoerper, Tom1 antikoerper
- Hintergrund
- This gene was identified as a target of the v-myb oncogene. The encoded protein shares its N-terminal domain in common with proteins associated with vesicular trafficking at the endosome. It is recruited to the endosomes by its interaction with endofin. Several alternatively spliced transcript variants encoding different isoforms have been found for this gene.
- Molekulargewicht
- 54 kDa (MW of target protein)
-